PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_74965_iso_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family SBP
Protein Properties Length: 186aa    MW: 20811.7 Da    PI: 7.528
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_74965_iso_1genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP133.76.1e-4276152278
                                          -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S CS
                                  SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrk 75 
                                          Cqv++Ceadls++k+yh+rhkvCe h+ka+vv+v+g +qrfCqqCsrfh+lsefD++krsCrrrLa+hnerrrk
  cra_locus_74965_iso_1_len_791_ver_3  76 CQVDKCEADLSSCKKYHQRHKVCEYHAKAQVVIVAGFRQRFCQQCSRFHDLSEFDDAKRSCRRRLAGHNERRRK 149
                                          ************************************************************************** PP

                                          --- CS
                                  SBP  76 kqa 78 
                                          +++
  cra_locus_74965_iso_1_len_791_ver_3 150 HSS 152
                                          875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5114131.70173150IPR004333Transcription factor, SBP-box
SuperFamilySSF1036129.03E-3875153IPR004333Transcription factor, SBP-box
Gene3DG3DSA:4.10.1100.101.7E-3275137IPR004333Transcription factor, SBP-box
PfamPF031107.4E-3276149IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 186 aa     Download sequence    Send to blast
XTLFSFRAAA AAAAKEEEEE YDDSAEEEEE EDDQFEAEES YNPKKRMNLG GGSAGKKGST  60
TTMGGGGGVA VVIQGCQVDK CEADLSSCKK YHQRHKVCEY HAKAQVVIVA GFRQRFCQQC  120
SRFHDLSEFD DAKRSCRRRL AGHNERRRKH SSELHGEAAA ATRIKKNQCR QSGEGGRTLH  180
HDFHIR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-3573149884squamosa promoter binding protein-like 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00634PBMTransfer from PK22320.1Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010260271.17e-47PREDICTED: squamosa promoter-binding protein 1
SwissprotQ387403e-42SBP2_ANTMA; Squamosa promoter-binding protein 2
TrEMBLA0A0K2CJC76e-44A0A0K2CJC7_PLAAC; Squamosa promoter binding protein-like 3b
STRINGVIT_12s0028g03350.t018e-43(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA74924105